The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the RRM domain of TRNA selenocysteine associated protein. To be Published
    Site RSGI
    PDB Id 2div Target Id hss001001121.2
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13243, Molecular Weight 9565.66 Da.
    Residues 86 Isoelectric Point 8.64
    Sequence maaslwmgdlepymdenfisrafatmgetvmsvkiirnrltgipagycfvefadlataekclhkingkp lpgatpakrfklnyaty
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2div

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch