The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the RRM domain of KIAA0430 protein. To be Published
    Site RSGI
    PDB Id 2diu Target Id hsk002100419.2
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12710, Molecular Weight 9376.18 Da.
    Residues 83 Isoelectric Point 9.10
    Sequence chtllyvynlpankdgksvsnrlrrlsdncggkvlsitgcsailrfinqdsaeraqkrmenedvfgnri ivsftpknrelcet
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2diu

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch