The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the BSD domain of human TFIIH basal transcription factor complex p62 subunit. To be Published
    Site RSGI
    PDB Id 2dii Target Id hsk003002104.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12866, Molecular Weight 5781.36 Da.
    Residues 48 Isoelectric Point 6.41
    Sequence fkrkankeleeknrmlqedpvlfqlykdlvvsqvisaeefwanrlnvn
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2dii

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch