The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title One sequence two fold ? : Correct fold of the zf-B-box domain from human tripartite motif protein 39. To be Published
    Site RSGI
    PDB Id 2did Target Id hsi002005913.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12404, Molecular Weight 4501.89 Da.
    Residues 40 Isoelectric Point 5.54
    Sequence eslcpqhhealslfcyedqeavclicaishthrahtvvpl
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Metals ZN (ZINC) x 2


    Google Scholar output for 2did

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch