The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the 12th filamin domain from human Filamin-B. To be Published
    Site RSGI
    PDB Id 2dic Target Id hsk003002600.5
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12884, Molecular Weight 10177.83 Da.
    Residues 98 Isoelectric Point 5.69
    Sequence gcqpsrvqaqgpglkeaftnkpnvftvvtrgagigglgitvegpseskincrdnkdgscsaeyipfapg dydvnityggahipgspfrvpvkdvvdps
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2dic

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch