.
The Open Protein Structure Annotation Network
PDB Keyword
.

2di9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the 9th filamin domain from human Filamin-B. To be Published
    Site RSGI
    PDB Id 2di9 Target Id hsk003002600.4
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12883, Molecular Weight 12203.93 Da.
    Residues 118 Isoelectric Point 4.38
    Sequence dvtydghpvpgspytveaslppdpskvkahgpglegglvgkpaeftidtkgagtgglgltvegpceaki ecsdngdgtcsvsylptkpgeyfvnilfeevhipgspfkadiempfdps
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2di9

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch