.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dhm

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the BolA protein from Escherichia coli. To be Published
    Site RSGI
    PDB Id 2dhm Target Id eco001000400.2
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS12264, Molecular Weight 11593.64 Da.
    Residues 100 Isoelectric Point 6.19
    Sequence mmirerieeklraafqpvflevvdesyrhnvpagseshfkvvlvsdrftgerflnrhrmiystlaeels ttvhalalhtytikeweglqdtvfasppcrg
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2dhm

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch