The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Large conformational changes in the Escherichia coli tryptophan synthase beta(2) subunit upon pyridoxal 5'-phosphate binding. Febs J. 277 2157-2170 2010
    Site RSGI
    PDB Id 2dh5 Target Id eco002001253.1
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS12279, Molecular Weight 31478.42 Da.
    Residues 292 Isoelectric Point 6.31
    Sequence mttllnpyfgefggmyvpqilmpalrqleeafvsaqkdpefqaqfndllknyagrptaltkcqnitagt nttlylkredllhggahktnqvlgqallakrmgkteiiaetgagqhgvasalasallglkcriymgakd verqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsyetahymlgtaagphpyptivrefqrm igeetkaqileregrlpdaviacvgggsnaigmfadfinetnvgligvepgghgietgehgaplkhgrv giyfgmkapmmqtedg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.90 Rfree 0.244
    Matthews' coefficent 4.12 Rfactor 0.196
    Waters 9 Solvent Content 70.15

    Ligand Information


    Google Scholar output for 2dh5

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch