.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dgz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the Helicase and RNase D C-terminal domain in Werner syndrome ATP-dependent helicase. To be Published
    Site RSGI
    PDB Id 2dgz Target Id hsk003001883.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12858, Molecular Weight 11075.28 Da.
    Residues 100 Isoelectric Point 8.82
    Sequence ssqpvisaqeqetqivlygklvearqkhankmdvppailatnkilvdmakmrpttvenvkridgvsegk aamlaplwevikhfcqtnsvqtdlfsstkpq
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2dgz

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch