.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dgt

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the second RNA binding domain in RNA-binding protein 30. To be Published
    Site RSGI
    PDB Id 2dgt Target Id hsi002005506.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12391, Molecular Weight 8951.67 Da.
    Residues 79 Isoelectric Point 6.32
    Sequence kastklhvgnisptctnqelrakfeeygpviecdivkdyafvhmeraedaveairgldntefqgkrmhv qlstsrlrta
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2dgt

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch