.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dgp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the N-terminal RNA binding domain in Bruno-like 4 RNA-binding protein. To be Published
    Site RSGI
    PDB Id 2dgp Target Id hsi002003720.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12355, Molecular Weight 10577.65 Da.
    Residues 93 Isoelectric Point 7.79
    Sequence mkdhdaiklfigqiprnldekdlkplfeefgkiyeltvlkdrftgmhkgcafltyceresalkaqsalh eqktlpgmnrpiqvkpadsesrgg
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2dgp

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch