.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dfa

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Lactam Utilization Protein from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2dfa Target Id ttk003001206.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14534, Molecular Weight 26723.05 Da.
    Residues 250 Isoelectric Point 5.93
    Sequence mkvdlnadagesygafayghdreifplvssanlacgfhggspgrileavrlakahgvavgahpgfpdlv gfgrremalspeevyadvlyqigalsaflkaeglplhhvkphgalylkacrdretaraialavkafdpg lplvvlpgtvyeeearkaglrvvleafperaylrsgqlaprsmpgswitdpeeaarralrmvlegkvea ldggevavradtlcihgdnpnapevaravrealeqagvevraf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.232
    Matthews' coefficent 2.36 Rfactor 0.213
    Waters 134 Solvent Content 47.99

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2dfa

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch