The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of family 5 uracil-DNA glycosylase bound to DNA. J.Mol.Biol. 373 839-850 2007
    Site RSGI
    PDB Id 2dem Target Id ttk003000722.3
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14420, Molecular Weight 24284.75 Da.
    Residues 219 Isoelectric Point 9.72
    Sequence mdreafvqtltacrlcprlvawreevvgrkrafrgepywarpvpgfgdpearillfglapgahgsnrtg rpftgdasgaflypllheaglsskpeslpgddlrlygvyltaavrcappknkptpeelracarwtevel gllpevrvyvalgrialeallahfglrksahpfrhgahyplpggrhllasyhvsrqntqtgrltremfl evlmeakrlagl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.95 Rfree 0.225
    Matthews' coefficent 3.61 Rfactor 0.2
    Waters 301 Solvent Content 65.96

    Ligand Information


    Google Scholar output for 2dem

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch