.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dek

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of project ID PH0725 from Pyrococcus horikoshii OT3 at 1.65 A resolution. To be Published
    Site RSGI
    PDB Id 2dek Target Id pho001000725.2
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13868, Molecular Weight 29574.78 Da.
    Residues 265 Isoelectric Point 5.76
    Sequence mvlyfiglglyderditvkgleiakkcdyvfaefytslmagttlgriqkligkeirvlsredvelnfen ivlplakendvafltpgdplvatthaelrirakragvesyvihapsiysavgitglhiykfgksatvay pegnwfptsyydvikenaerglhtllfldikaekrmymtaneamelllkvedmkkggvftddtlvvvla ragslnptiragyvkdliredfgdpphilivpgklhiveaeylveiagapreilrvnv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.65 Rfree 0.224
    Matthews' coefficent 3.17 Rfactor 0.21
    Waters 606 Solvent Content 61.22

    Ligand Information
    Ligands SAH (S-ADENOSYL-L-HOMOCYSTEINE) x 1
    Metals NA (SODIUM) x 1

    Jmol

     
    Google Scholar output for 2dek

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch