.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dei

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of galaktokinase from Pyrococcus horikoshii. To be Published
    Site RSGI
    PDB Id 2dei Target Id pho001000369.2
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13816, Molecular Weight 28873.65 Da.
    Residues 255 Isoelectric Point 6.14
    Sequence mikvkspgrvnligehtdytygyvmpmainlytkieaekhgevilysehfgeerkfslndlrkenswid yvkgifwvlkesdyevggikgrvsgnlplgaglsssasfevgiletldklynlkldslskvllakkaen efvgvpcgildqfavvfgregnvifldthtldyeyipfpkdvsilvfytgvrrelasseyaerkhiaee slkilgkgsskevregelsklpplhrkffgyivrenarvlevrdalke
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.22132
    Matthews' coefficent 2.02 Rfactor 0.17672
    Waters 292 Solvent Content 39.19

    Ligand Information
    Ligands GLA (ALPHA) x 1;MAP (MAGNESIUM-5'-ADENYLY-IMIDO-TRIPHOSPHATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 2dei

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch