.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dds

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural Basis of the Sphingomyelin Phosphodiesterase Activity in Neutral Sphingomyelinase from Bacillus cereus. J.Biol.Chem. 281 16157-16167 2006
    Site RSGI
    PDB Id 2dds Target Id ar_001000745.2
    Molecular Characteristics
    Source Bacillus cereus
    Alias Ids TPS12215, Molecular Weight 34306.38 Da.
    Residues 306 Isoelectric Point 5.56
    Sequence evsttqndtlkvmthnvymlstnlypnwgqteradligaadyiknqdvvilnevfdnsasdrllgnlkk eypnqtavlgrssgsewdktlgnyssstpedggvaivskwpiaekiqyvfakgcgpdnlsnkgfvytki kkndrfvhvigthlqaedsmcgktspasvrtnqlkeiqdfiknknipnneyvliggdmnvnkinaennn dseyasmfktlnasvpsytghtatwdattnsiakynfpdspaeyldyiiaskdhanpsyienkvlqpks pqwtvtswfqkytyndysdhypveatismk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.80 Rfree 0.232
    Matthews' coefficent 2.18 Rfactor 0.202
    Waters 1116 Solvent Content 43.61

    Ligand Information
    Ligands
    Metals CO (COBALT) x 12

    Jmol

     
    Google Scholar output for 2dds

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch