The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of human myo-inositol monophosphatase 2, the product of the putative susceptibility gene for bipolar disorder, schizophrenia, and febrile seizures. Proteins 67 732-742 2007
    Site RSGI
    PDB Id 2ddk Target Id ar_001000354.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12144, Molecular Weight 31319.09 Da.
    Residues 288 Isoelectric Point 6.15
    Sequence mkpsgedqaalaagpweecfqaavqlalragqiirkalteekrvstktsaadlvtetdhlvedliisel rerfpshrfiaeeaaasgakcvlthsptwiidpidgtcnfvhrfptvavsigfavrqelefgviyhcte erlytgrrgrgafcngqrlrvsgetdlskalvlteigpkrdpatlklflsnmerllhakahgvrvigss tlalchlasgaadayyqfglhcwdlaaatviireaggividtsggpldlmacrvvaastremamliaqa lqtinygrddek
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.70 Rfree 0.301
    Matthews' coefficent 2.59 Rfactor 0.26
    Waters 22 Solvent Content 52.49

    Ligand Information


    Google Scholar output for 2ddk

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch