The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the TT1209 from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2dct Target Id ttk003001209.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14664, Molecular Weight 11482.72 Da.
    Residues 105 Isoelectric Point 6.28
    Sequence meikdlkrlarynpekmakipvfqsermlydlyallpgqaqkvhvhegsdkvyyalegevvvrvgeeea llapgmaafapagaphgvrnesaspalllvvtaprp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.45 Rfree 0.209
    Matthews' coefficent 3.18 Rfactor 0.199
    Waters 378 Solvent Content 61.31

    Ligand Information
    Metals NA (SODIUM) x 1;CL (CHLORIDE) x 1


    Google Scholar output for 2dct

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch