The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of mouse glutathione S-transferase, mu7 (GSTM7) at 1.6 A resolution. To be Published
    Site RSGI
    PDB Id 2dc5 Target Id mmt007000002.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13466, Molecular Weight 25678.29 Da.
    Residues 218 Isoelectric Point 6.84
    Sequence mpmtlgywdirglahairlfleytdssyeekrytmgdapdydqsqwlnekfklgldfpnlpylidgshk itqsnailrylgrkhnlcgeteverirvdilenqlmdnrmvlarlcynadfeklkpgyleqlpgmmrly seflgkrpwfagdkitfvdfiaydvlernqvfeakcldafpnlkdfiarfeglkkisdymktsrflprp mftkmatwgsn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.60 Rfree 0.202
    Matthews' coefficent 2.17 Rfactor 0.188
    Waters 563 Solvent Content 43.27

    Ligand Information


    Google Scholar output for 2dc5

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch