.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dc4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of PH1012 protein from Pyrococcus Horikoshii OT3. To be Published
    Site RSGI
    PDB Id 2dc4 Target Id pho001001012.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13964, Molecular Weight 19578.59 Da.
    Residues 165 Isoelectric Point 5.38
    Sequence meievkfrvnfedikrkieglgakffgieeqedvyfelpspkllrvrkinntgksyitykeildkrnee fyelefevqdpegaielfkrlgfkvqgvvkkrrwiyklnnvtfelnrvekagdfldievitsnpeegkk iiwdvarrlglkeedvepklyieling
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.65 Rfree 0.236
    Matthews' coefficent 2.31 Rfactor 0.21
    Waters 407 Solvent Content 46.71

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 5

    Jmol

     
    Google Scholar output for 2dc4

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch