The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title High-resolution structure of human cytoglobin: identification of extra N- and C-termini and a new dimerization mode. Acta Crystallogr.,Sect.D 62 671-677 2006
    Site RSGI
    PDB Id 2dc3 Target Id my_001000023.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13692, Molecular Weight 21684.79 Da.
    Residues 193 Isoelectric Point 6.42
    Sequence gshmekvpgemeierrerseelseaerkavqamwarlyancedvgvailvrffvnfpsakqyfsqfkhm edplemerspqlrkhacrvmgalntvvenlhdpdkvssvlalvgkahalkhkvepvyfkilsgvilevv aeefasdfppetqrawaklrgliyshvtaaykevgwvqqvpnattppatlpssgp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.68 Rfree 0.181
    Matthews' coefficent 1.99 Rfactor 0.14
    Waters 265 Solvent Content 38.10

    Ligand Information


    Google Scholar output for 2dc3

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch