.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dbq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of archaeal glyoxylate reductase from Pyrococcus horikoshii OT3 complexed with nicotinamide adenine dinucleotide phosphate. Acta Crystallogr.,Sect.D 63 357-365 2007
    Site RSGI
    PDB Id 2dbq Target Id pho001000597.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13835, Molecular Weight 42544.24 Da.
    Residues 376 Isoelectric Point 8.40
    Sequence malsilflsiasltlsssliidhyfhlsflrnplksqsgggkmkpkvfitreipevgikmledefevev wgdekeipreillkkvkevdalvtmlseridkevfenapklrivanyavgydnidieeatkrgiyvtnt pdvltdatadlafalllatarhvvkgdrfvrsgewkkrgvawhpkwflgydvygktigiiglgrigqai akrakgfnmrilyysrtrkeeverelnaefkpledllresdfvvlavpltretyhlineerlklmkkta iliniargkvvdtnalvkalkegwiagagldvfeeepyyneelfkldnvvltphigsasfgaregmael vaknliafkrgeipptlvnrevikirkpgfe
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.1429
    Matthews' coefficent 5.14 Rfactor 0.131
    Waters 380 Solvent Content 76.05

    Ligand Information
    Ligands SO4 (SULFATE) x 2;NAP (NADP) x 1;GOL (GLYCEROL) x 5
    Metals

    Jmol

     
    Google Scholar output for 2dbq

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch