.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dbo

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of D-Tyr-tRNA(Tyr) deacylase from Aquifex aeolicus. To be Published
    Site RSGI
    PDB Id 2dbo Target Id aae001000428.1
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS12037, Molecular Weight 16966.81 Da.
    Residues 148 Isoelectric Point 5.74
    Sequence mraviqrvkkswvevdgkvvgsineglnvflgvrkgdteedieklvnkilnlrifedergkfqysvldi kgeilvvsqftlyanvkkgrrpsfeeaeepkrakelyekfvdkikesglkvetgifgammdvfienwgp vtiiidsrei
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.76 Rfree 0.284
    Matthews' coefficent 3.28 Rfactor 0.23
    Waters 32 Solvent Content 62.52

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2dbo

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch