The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of a Hypothetical Protein JW0805 at High pH from Escherichia coli. To be published
    Site RSGI
    PDB Id 2dbn Target Id eco002000805.2
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS12277, Molecular Weight 47326.98 Da.
    Residues 421 Isoelectric Point 5.56
    Sequence mastftsdtlpadhkaairqmkhalraqlgdvqqifnqlsddiatrvaeinalkaqgdavwpvlsyadi kaghvtaeqreqikrrgcavikghfpreqalgwdqsmldyldrnrfdevykgpgdnffgtlsasrpeiy piywsqaqmqarqseemanaqsflnrlwtfesdgkqwfnpdvsviypdrirrrppgttskglgahtdsg alerwllpayqrvfanvfngnlaqydpwhaahrteveeytvdnttkcsvfrtfqgwtalsdmlpgqgll hvvpipeamayvllrpllddvpedelcgvapgrvlpvseqwhplliealtsipkleagdsvwwhcdvih svapvenqqgwgnvmyipaapmceknlayahkvkaalekgaspgdfpredyetnwegrftladlnihgk ralgmdv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.2
    Matthews' coefficent 2.36 Rfactor 0.187
    Waters 669 Solvent Content 47.81

    Ligand Information
    Ligands SO4 (SULFATE) x 3


    Google Scholar output for 2dbn

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch