.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dbf

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the Death domain in human Nuclear factor NF-kappa-B p105 subunit. To be Published
    Site RSGI
    PDB Id 2dbf Target Id hso002001310.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12977, Molecular Weight 9620.53 Da.
    Residues 87 Isoelectric Point 4.79
    Sequence dmkqlaedvklqlyklleipdpdknwatlaqklglgilnnafrlspapsktlmdnyevsggtvrelvea lrqmgyteaieviqaass
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2dbf

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch