The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of PH0061. To be Published
    Site RSGI
    PDB Id 2dbb Target Id pho001000061.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13758, Molecular Weight 17590.88 Da.
    Residues 151 Isoelectric Point 9.41
    Sequence mdcmrkldrvdmqlvkilsensrltyreladilnttrqriarridklkklgiirkftiipdidklgymy aivlikskvpsdadkviseisdieyvksvekgvgryniivrlllpkdikdaenliseflqriknaenve vilisevrkfeii
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.234
    Matthews' coefficent 2.59 Rfactor 0.198
    Waters 92 Solvent Content 52.57

    Ligand Information


    Google Scholar output for 2dbb

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch