.
The Open Protein Structure Annotation Network
PDB Keyword
.

2db1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the RNA binding domain in heterogeneous nuclear ribonucleoprotein F homolog. To be Published
    Site RSGI
    PDB Id 2db1 Target Id mmt008001147.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13645, Molecular Weight 11841.74 Da.
    Residues 105 Isoelectric Point 5.27
    Sequence mmlgpeggegyvvklrglpwscsiedvqnflsdctihdgvagvhfiytregrqsgeafveleseddvkl alkkdresmghryievfkshrtemdwvlkhsgpnsa
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2db1

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch