The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The solution structure of the MYND domain (LEU384-CYS430) of human Zinc finger MYND domain containing protein 10. To be Published
    Site RSGI
    PDB Id 2dan Target Id hss001004006.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13360, Molecular Weight 5535.04 Da.
    Residues 47 Isoelectric Point 8.50
    Sequence leavaperprcaycsaeaskrcsrcqnewyccrecqvkhwekhgktc
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Metals ZN (ZINC) x 2


    Google Scholar output for 2dan

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch