.
The Open Protein Structure Annotation Network
PDB Keyword
.

2da7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the homeobox domain of Zinc finger homeobox protein 1b (Smad interacting protein 1). To be Published
    Site RSGI
    PDB Id 2da7 Target Id hsk002100553.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12716, Molecular Weight 6884.53 Da.
    Residues 58 Isoelectric Point 6.51
    Sequence spinpykdhmsvlkayyamnmepnsdellkisiavglpqefvkewfeqrkvyqysnsr
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2da7

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch