The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the ArfGap domain of human RIP. To be Published
    Site RSGI
    PDB Id 2d9l Target Id hsi002022341.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12541, Molecular Weight 14099.54 Da.
    Residues 121 Isoelectric Point 9.04
    Sequence lkmlrdmtglphnrkcfdcdqrgptyvnmtvgsfvctscsgslrglnpphrvksismttftqqeieflq khgnevckqiwlglfddrssaipdfrdpqkvkeflqekyekkrwyvppeqak
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Metals ZN (ZINC) x 1


    Google Scholar output for 2d9l

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch