The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The C-terminal BAG domain of BAG5 induces conformational changes of the Hsp70 nucleotide-binding domain for ADP-ATP exchange. Structure 18 309-319 2010
    Site RSGI
    PDB Id 2d9d Target Id hss001003994.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13359, Molecular Weight 8836.86 Da.
    Residues 76 Isoelectric Point 7.82
    Sequence silkiekvlkrmreiknellqaqnpselylssktelqgligqldevsleknpcirearrravievqtli tyidlke
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2d9d

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch