.
The Open Protein Structure Annotation Network
PDB Keyword
.

2d96

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the Death domain of Nuclear factor NF-kappa-B p100. to be published
    Site RSGI
    PDB Id 2d96 Target Id hsk003000411.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12823, Molecular Weight 10222.80 Da.
    Residues 96 Isoelectric Point 4.32
    Sequence pglslgdtalqnleqlldgpeaqgswaelaerlglrslvdtyrqttspsgsllrsyelaggdlagllea lsdmgleegvrllrgpetrdklpstev
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2d96

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch