The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the third PDZ domain of PDZ domain containing protein 1. To be published
    Site RSGI
    PDB Id 2d90 Target Id mmt008001497.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13658, Molecular Weight 9481.29 Da.
    Residues 89 Isoelectric Point 5.31
    Sequence rvvvikkgsngygfylragpeqkgqiikdiepgspaeaaglknndlvvavngksvealdhdgvvemirk ggdqttllvldkeaesiysl
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2d90

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch