The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the B-box domain of the zinc finger FYVE domain-containing protein 19 from Mus musculus. To be Published
    Site RSGI
    PDB Id 2d8v Target Id mmt007007399.2
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13500, Molecular Weight 6311.70 Da.
    Residues 54 Isoelectric Point 5.68
    Sequence lpwccicnedatlrcagcdgdlycarcfreghdnfdlkehqtspyhprrpcqeh
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Metals ZN (ZINC) x 2


    Google Scholar output for 2d8v

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch