.
The Open Protein Structure Annotation Network
PDB Keyword
.

2d8r

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the thap domain of the human thap domain-containing protein 2. To be Published
    Site RSGI
    PDB Id 2d8r Target Id hsi002006992.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12416, Molecular Weight 10026.19 Da.
    Residues 86 Isoelectric Point 9.89
    Sequence mptncaaagcattynkhinisfhrfpldpkrrkewvrlvrrknfvpgkhtflcskhfeascfdltgqtr rlkmdavptifdfcthi
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 1

    Jmol

     
    Google Scholar output for 2d8r

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch