The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the MYND domain of the human zinc finger MYND domain-containing protein 10. To be Published
    Site RSGI
    PDB Id 2d8q Target Id hss001004026.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13361, Molecular Weight 6545.14 Da.
    Residues 57 Isoelectric Point 8.71
    Sequence leavaperprcaycsaeaskrcsrcqnewyccrecqvkhwekhgktcvlaaqgdrak
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Metals ZN (ZINC) x 2


    Google Scholar output for 2d8q

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch