The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of human recoverin at 2.2 A resolution. To be Published
    Site RSGI
    PDB Id 2d8n Target Id hsi002004436.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12366, Molecular Weight 23129.09 Da.
    Residues 200 Isoelectric Point 5.06
    Sequence mgnsksgalskeileelqlntkfseeelcswyqsflkdcptgritqqqfqsiyakffpdtdpkayaqhv frsfdsnldgtldfkeyvialhmttagktnqklewafslydvdgngtisknevleivmaifkmitpedv kllpddentpekraekiwkyfgkndddkltekefiegtlankeilrliqfepqkvkekmkna
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.20 Rfree 0.237
    Matthews' coefficent 2.48 Rfactor 0.189
    Waters 87 Solvent Content 50.45

    Ligand Information


    Google Scholar output for 2d8n

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch