The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the sam-domain of mouse phosphatidyl ceramidecholinephosphotransferase 1. To be Published
    Site RSGI
    PDB Id 2d8c Target Id mmt008001227.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13646, Molecular Weight 9947.96 Da.
    Residues 84 Isoelectric Point 5.47
    Sequence mlsartmkevvywspkkvadwllenampeyceplehftgqdlinltqedfkkpplyrvssdngqrlldm ietlkmehhmeahkn
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2d8c

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch