.
The Open Protein Structure Annotation Network
PDB Keyword
.

2d89

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the CH domain from human EH domain binding protein 1. To be Published
    Site RSGI
    PDB Id 2d89 Target Id hsk002100880.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12737, Molecular Weight 12178.41 Da.
    Residues 106 Isoelectric Point 9.22
    Sequence pnasqsllvwckevtknyrgvkitnfttswrnglsfcailhhfrpdlidykslnpqdikennkkaydgf asigisrllepsdmvllaipdkltvmtylyqirahfs
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2d89

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch