.
The Open Protein Structure Annotation Network
PDB Keyword
.

2d7u

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of hypothetical adenylosuccinate synthetase, PH0438 from Pyrococcus horikoshii OT3. To be Published
    Site RSGI
    PDB Id 2d7u Target Id pho001000438.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13820, Molecular Weight 37230.53 Da.
    Residues 339 Isoelectric Point 5.45
    Sequence mpsvivvggqwgdegkgsivaylslhdepeiiarggvgtnaghsvvingkkyavrqiptgfmqtkarll igagvlvdpevffheleqlkdfnvkdrvgidyrcaiieekhkqldrtngylhgkigttgsgcgpanadr vmrkakqakdvkelepyltdvaqeindaldegslvlvegtqgfglslyygtypyvtskdvtassvaadv gigptrvdevivvfksfptrvgagpfptempmeeadrlglveygtvtgrrrrvgwfdfemarysaring atmlavtmldkydkeafgvtdydklprkakefieeieervgvpvgliktgpelehiidrrdti
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.50 Rfree 0.285
    Matthews' coefficent 2.17 Rfactor 0.236
    Waters 106 Solvent Content 43.23

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2d7u

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch