The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural basis of CoA recognition by the Pyrococcus single-domain CoA-binding proteins. J.STRUCT.FUNCT.GENOM. 7 119-129 2006
    Site RSGI
    PDB Id 2d5a Target Id pho001001109.2
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13974, Molecular Weight 16720.56 Da.
    Residues 144 Isoelectric Point 6.18
    Sequence meetrpidgltdedireiltrykkialvgaspkperdanivmkyllehgydvypvnpkyeevlgrkcyp svldipdkievvdlfvkpkltmeyveqaikkgakvvwfqyntynreaskkadeagliivanrcmmrehe rllgek
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree
    Matthews' coefficent 3.09 Rfactor 0.225
    Waters 119 Solvent Content 60.16

    Ligand Information
    Ligands COA (COENZYME) x 1


    Google Scholar output for 2d5a

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch