.
The Open Protein Structure Annotation Network
PDB Keyword
.

2d4r

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of a conserved hypothetical protein, TTHA0849 from Thermus thermophilus HB8, at 2.4 A resolution: a putative member of the StAR-related lipid-transfer (START) domain superfamily. Acta Crystallogr.,Sect.F 61 1027-1031 2005
    Site RSGI
    PDB Id 2d4r Target Id ttk003001201.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14533, Molecular Weight 17083.72 Da.
    Residues 147 Isoelectric Point 5.16
    Sequence mpevraeryipappervyrlakdleglkpylkeveslevvaregartrsrwvavamgkkvrwleeeewd denlrnrffspegdfdryegtwvflpegegtrvvltltyeltipifggllrklvqklmqenvesllkgl eervlaass
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.40 Rfree 0.299
    Matthews' coefficent 1.93 Rfactor 0.223
    Waters 376 Solvent Content 36.35

    Ligand Information
    Ligands SO4 (SULFATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 2d4r

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch