.
The Open Protein Structure Annotation Network
PDB Keyword
.

2d4p

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of TTHA1254 (wild type) from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2d4p Target Id ttk003001619.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14757, Molecular Weight 15461.88 Da.
    Residues 141 Isoelectric Point 6.19
    Sequence mrfrpfteedldrlnrlagkrpvslgalrffartghsflaeegeepmgfalaqavwqgeattvlvtrie grsvealrgllravvksaydagvyevalhldperkeleealkaegfalgplvlavrvlgsrgargetrg vle
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.19485
    Matthews' coefficent 2.65 Rfactor 0.1683
    Waters 157 Solvent Content 53.62

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2d4p

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch