.
The Open Protein Structure Annotation Network
PDB Keyword
.

2d2e

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Atypical Cytoplasmic ABC-ATPase SufC from Thermus thermophilus HB8. J.Mol.Biol. 353 1043-1054 2005
    Site RSGI
    PDB Id 2d2e Target Id ttp001001838.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14836, Molecular Weight 27572.30 Da.
    Residues 250 Isoelectric Point 5.04
    Sequence msqleirdlwasidgetilkgvnlvvpkgevhalmgpngagkstlgkilagdpeytvergeilldgeni lelspderarkglflafqypvevpgvtianflrlalqaklgrevgvaefwtkvkkalelldwdesylsr ylnegfsggekkrneilqllvleptyavldetdsgldidalkvvargvnamrgpnfgalvithyqriln yiqpdkvhvmmdgrvvatggpelaleleakgyewlkekvkega
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.223
    Matthews' coefficent 2.11 Rfactor 0.194
    Waters 218 Solvent Content 41.63

    Ligand Information
    Ligands GOL (GLYCEROL) x 2
    Metals CL (CHLORIDE) x 1

    Jmol

     
    Google Scholar output for 2d2e

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch