The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of TT0321 from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2d1y Target Id ttk003000321.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14334, Molecular Weight 26959.51 Da.
    Residues 256 Isoelectric Point 5.62
    Sequence mglfagkgvlvtggargigraiaqafaregalvalcdlrpegkevaeaiggaffqvdlederervrfve eaayalgrvdvlvnnaaiaapgsaltvrlpewrrvlevnltapmhlsalaaremrkvgggaivnvasvq glfaeqenaaynaskgglvnltrslaldlaplrirvnavapgaiateavleaialspdpertrrdwedl halrrlgkpeevaeavlflasekasfitgailpvdggmtasfmmagrpv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.65 Rfree 0.194
    Matthews' coefficent 2.00 Rfactor 0.175
    Waters 827 Solvent Content 38.12

    Ligand Information


    Google Scholar output for 2d1y

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch