.
The Open Protein Structure Annotation Network
PDB Keyword
.

2d1t

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural basis for the spectral difference in luciferase bioluminescence. Nature 440 372-376 2006
    Site RSGI
    PDB Id 2d1t Target Id my_001000084.4
    Molecular Characteristics
    Source Luciola cruciata
    Alias Ids TPS13741, Molecular Weight 60069.24 Da.
    Residues 548 Isoelectric Point 7.07
    Sequence menmendenivvgpkpfypieegsagtqlrkymeryaklgaiaftnavtgvdysyaeylekscclgkal qnyglvvdgrialcsenceeffipviaglfigvgvaptneiytlrelvhslgiskptivfsskkgldkv itvqktvttiktivildskvdyrgyqcldtfikrntppgyqassfktvevdrkeqvalimnssgstglp kgvqlthenivtrfshardpiygnqvspgtavltvvpfhhgfgmfttlgylicgfrvvmltkfdeetfl ktlqdykctnvilvptlfailnksellnkydlsnlveiasggaplskevgeavarrfnlpgvrqgyglt ettsaiiitpegddkpgasgkvvplfkakvidldtkkslgpnrrgevcvkgpmlmkgyvnnpeatkeli deegwlhtgdigyydeekhffivdrlkslikykgyqvppaelesvllqhpsifdagvagvpdpvagelp gavvvlesgknmtekevmdyvasqvsnakrlrggvrfvdevpkgltgkidgraireilkkpvakm
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.45 Rfree 0.18195
    Matthews' coefficent 2.27 Rfactor 0.16439
    Waters 843 Solvent Content 45.30

    Ligand Information
    Ligands SLU (5'-O-[N-(DEHYDROLUCIFERYL)-SULFAMOYL]) x 1
    Metals CL (CHLORIDE) x 2

    Jmol

     
    Google Scholar output for 2d1t

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch