.
The Open Protein Structure Annotation Network
PDB Keyword
.

2d1c

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure Of TT0538 protein from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2d1c Target Id ttk003000538.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14408, Molecular Weight 54435.70 Da.
    Residues 496 Isoelectric Point 6.33
    Sequence mplittetgkkmhvledgrklitvipgdgigpecveatlkvleaakaplayevreagasvfrrgiasgv pqetiesirktrvvlkgpletpvgygeksanvtlrklfetyanvrpvrefpnvptpyagrgidlvvvre nvedlyagiehmqtpsvaqtlkliswkgsekivrfafelaraegrkkvhcatksnimklaegtlkrafe qvaqeypdieavhiivdnaahqlvkrpeqfevivttnmngdilsdltsgligglgfapsanignevaif eavhgsapkyagknvinptavllsavmmlryleefatadlienallytleegrvltgdvvgydrgaktt eyteaiiqnlgktprktqvrgykpfrlpqvdgaiapivprsrrvvgvdvfvetnllpealgkaledlaa gtpfrlkmisnrgtqvypptggltdlvdhyrcrflytgegeakdpeildlvsrvasrfrwmhleklqef dgepgftkaqged
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.238
    Matthews' coefficent 2.30 Rfactor 0.207
    Waters 870 Solvent Content 46.80

    Ligand Information
    Ligands NAP (NADP) x 2;CIT (CITRIC) x 2
    Metals

    Jmol

     
    Google Scholar output for 2d1c

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch