The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of human indoleamine 2,3-dioxygenase: catalytic mechanism of O2 incorporation by a heme-containing dioxygenase. Proc.Natl.Acad.Sci.Usa 103 2611-2616 2006
    Site RSGI
    PDB Id 2d0t Target Id my_001000021.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13686, Molecular Weight 45323.88 Da.
    Residues 403 Isoelectric Point 6.87
    Sequence mahamenswtiskeyhideevgfalpnpqenlpdfyndwmfiakhlpdliesgqlrerveklnmlsidh ltdhksqrlarlvlgcitmayvwgkghgdvrkvlprniavpycqlskklelppilvyadcvlanwkkkd pnkpltyenmdvlfsfrdgdcskgfflvsllveiaaasaikviptvfkamqmqerdtllkalleiascl ekalqvfhqihdhvnpkaffsvlriylsgwkgnpqlsdglvyegfwedpkefaggsagqssvfqcfdvl lgiqqtaggghaaqflqdmrrymppahrnflcslesnpsvrefvlskgdaglreaydacvkalvslrsy hlqivtkyilipasqqpkenktsedpskleakgtggtdlmnflktvrstteksllkeg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.221
    Matthews' coefficent 3.00 Rfactor 0.191
    Waters 138 Solvent Content 58.70

    Ligand Information


    Google Scholar output for 2d0t

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch