The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure PH0520 protein from Pyrococcus horikoshii OT3. To be Published
    Site RSGI
    PDB Id 2d0i Target Id pho001000520.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13830, Molecular Weight 38046.49 Da.
    Residues 333 Isoelectric Point 8.77
    Sequence mrpkvgvllkmkrealeelkkyadveiilypsgeelkgvigrfdgiivspttkitrevlenaerlkvis chsagydnidleeatkrgiyvtkvsgllseavaeftvgliinlmrkihyadkfirrgeweshakiwtgf krieslygkkvgilgmgaigkaiarrlipfgvklyywsrhrkvnvekelkarymdidelleksdivila lpltrdtyhiineervkklegkylvnigrgalvdekavteaikqgklkgyatdvfekepvrehelfkye wetvltphyaglaleaqedvgfravenllkvlrgevpedlvnkevlevrpienvkml
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.95 Rfree 0.265
    Matthews' coefficent 2.50 Rfactor 0.235
    Waters 1030 Solvent Content 50.80

    Ligand Information


    Google Scholar output for 2d0i

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch