.
The Open Protein Structure Annotation Network
PDB Keyword
.

2czt

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural basis of the catalytic mechanism operating in open-closed conformers of lipocalin type prostaglandin D synthase. J.Biol.Chem. 284 22344-22352 2009
    Site RSGI
    PDB Id 2czt Target Id my_001000145.2
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13749, Molecular Weight 18594.95 Da.
    Residues 167 Isoelectric Point 7.93
    Sequence gsqghdtvqpnfqqdkflgrwysaglasnsswfrekkavlymaktvvapstegglnltstflrknqcet kimvlqpagapghytyssphsgsihsvsvveanydeyallfsrgtkgpgqdfrmatlysrtqtlkdelk ekfttfskaqglteedivflpqpdkciqe
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.278
    Matthews' coefficent 2.20 Rfactor 0.242
    Waters 32 Solvent Content 44.00

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2czt

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch